UBE2I antibody

Catalog No. ABIN629732

The Rabbit Polyclonal anti-UBE2I antibody is suitable to detect UBE2I in samples from Human, Mouse, Rat, Zebrafish (Danio rerio) and Dog. It has been validated for WB.

Quick Overview for UBE2I antibody (ABIN629732)

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2I antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2I Antibody

Purification: Purified

Immunogen: UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2I Blocking Peptide, (ABIN5616868), is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2I

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Alternative Name: UBE2I

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway