UBE2I antibody

Catalog No. ABIN629732

Product Details anti-UBE2I Antibody

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2I antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2I Blocking Peptide, catalog no. 33R-6431, is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2I

Target: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Alternative Name: UBE2I (UBE2I Products)

Synonyms: C358B7.1 antibody, P18 antibody, UBC9 antibody, ubc9 antibody, ube2ia antibody, zUbc9 antibody, 5830467E05Rik antibody, F830028O17Rik antibody, Ubce2i antibody, Ubce9 antibody, UbcE2A antibody, ubce9 antibody, T13J8.70 antibody, T13J8_70 antibody, UBIQUITIN-PROTEIN LIGASE antibody, ubiquitin conjugating enzyme 9 antibody, ubiquitin conjugating enzyme E2 I antibody, ubiquitin-conjugating enzyme E2Ib antibody, ubiquitin-conjugating enzyme E2L antibody, ubiquitin-conjugating enzyme E2I antibody, ubiquitin conjugating enzyme E2I S homeolog antibody, ubiquitin conjugating enzyme 9 antibody, SUMO-conjugating enzyme UBC9 antibody, UBE2I antibody, ube2ib antibody, UBE2L antibody, Ube2i antibody, ube2i.S antibody, UBC9 antibody, ubc-9 antibody, LOC108703134 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway