Cytokeratin 13 antibody (C-Term)

Catalog No. ABIN629751

This anti-Cytokeratin 13 antibody is a Rabbit Polyclonal antibody detecting Cytokeratin 13 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for Cytokeratin 13 antibody (C-Term) (ABIN629751)

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cytokeratin 13 Antibody

Binding Specificity: C-Term

Specificity: Cytokeratin 13 antibody was raised against the C terminal of KRT13

Purification: Purified

Immunogen: Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 13 Blocking Peptide, (ABIN937663), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 13

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Alternative Name: Cytokeratin 13

Background: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.

Molecular Weight: 46 kDa (MW of target protein)