LOC653186 antibody (N-Term)

Catalog No. ABIN629757

This anti-LOC653186 antibody is a Rabbit Polyclonal antibody detecting LOC653186 in WB. Suitable for Human.

Quick Overview for LOC653186 antibody (N-Term) (ABIN629757)

Target: LOC653186

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LOC653186 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LOC653186 Antibody

Binding Specificity: N-Term

Specificity: LOC653186 antibody was raised against the N terminal of LOC653186

Purification: Purified

Immunogen: LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC653186 Blocking Peptide, (ABIN5614533), is also available for use as a blocking control in assays to test for specificity of this LOC653186 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC653186 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOC653186

Target: LOC653186

Alternative Name: LOC653186

Background: The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 10 kDa (MW of target protein)