SIK1 antibody (N-Term)

Catalog No. ABIN629758

This Rabbit Polyclonal antibody specifically detects SIK1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SIK1 antibody (N-Term) (ABIN629758)

Target: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SIK1 Antibody

Binding Specificity: N-Term

Specificity: SNF1 LK antibody was raised against the N terminal of SNF1 K

Purification: Purified

Immunogen: SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SNF1LK Blocking Peptide, (ABIN5616317), is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIK1

Target: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Alternative Name: SNF1LK

Background: SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process