TSH receptor antibody (N-Term)

Catalog No. ABIN629760

This anti-TSH receptor antibody is a Rabbit Polyclonal antibody detecting TSH receptor in WB. Suitable for Human.

Quick Overview for TSH receptor antibody (N-Term) (ABIN629760)

Target: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSH receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSH receptor Antibody

Binding Specificity: N-Term

Specificity: TSHR antibody was raised against the N terminal of TSHR

Purification: Purified

Immunogen: TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TSHR Blocking Peptide, (ABIN937097), is also available for use as a blocking control in assays to test for specificity of this TSHR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSH receptor

Target: TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))

Alternative Name: TSHR

Background: TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis