TSH receptor antibody (N-Term)
-
- Target See all TSH receptor (TSHR) Antibodies
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSH receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TSHR antibody was raised against the N terminal of TSHR
- Purification
- Purified
- Immunogen
- TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
- Top Product
- Discover our top product TSHR Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TSHR Blocking Peptide, catalog no. 33R-1711, is also available for use as a blocking control in assays to test for specificity of this TSHR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSHR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSH receptor (TSHR) (Thyroid Stimulating Hormone Receptor (TSHR))
- Alternative Name
- TSHR (TSHR Products)
- Synonyms
- CHNG1 antibody, LGR3 antibody, hTSHR-I antibody, AI481368 antibody, hypothroid antibody, hyt antibody, pet antibody, TSHRA antibody, TSH-R antibody, thyroid stimulating hormone receptor antibody, tshr antibody, TSHR antibody, Tshr antibody
- Background
- TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-