SARDH antibody (Middle Region)

Catalog No. ABIN629761

This Rabbit Polyclonal antibody specifically detects SARDH in WB and IHC. It exhibits reactivity toward Mouse, Human, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for SARDH antibody (Middle Region) (ABIN629761)

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Reactivity: Mouse, Human, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SARDH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SARDH Antibody

Binding Specificity: Middle Region

Specificity: SARDH antibody was raised against the middle region of SARDH

Purification: Purified

Immunogen: SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SARDH Blocking Peptide, (ABIN937368), is also available for use as a blocking control in assays to test for specificity of this SARDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SARDH

Target: SARDH (Sarcosine Dehydrogenase (SARDH))

Alternative Name: SARDH

Background: The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.

Molecular Weight: 67 kDa (MW of target protein)