SARDH antibody (Middle Region)
-
- Target See all SARDH Antibodies
- SARDH (Sarcosine Dehydrogenase (SARDH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Rat, Human, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SARDH antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SARDH antibody was raised against the middle region of SARDH
- Purification
- Purified
- Immunogen
- SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ
- Top Product
- Discover our top product SARDH Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SARDH Blocking Peptide, catalog no. 33R-1982, is also available for use as a blocking control in assays to test for specificity of this SARDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SARDH (Sarcosine Dehydrogenase (SARDH))
- Alternative Name
- SARDH (SARDH Products)
- Synonyms
- BPR-2 antibody, DMGDHL1 antibody, SAR antibody, SARD antibody, SDH antibody, zgc:56363 antibody, sarcosine dehydrogenase antibody, sarcosine dehydrogenase, mitochondrial antibody, Sarcosine dehydrogenase antibody, SARDH antibody, SAV_6951 antibody, LOC5565677 antibody, LOC5572760 antibody, SDH antibody, NGR_b16520 antibody, Sinme_2254 antibody, sardh antibody, Sardh antibody
- Background
- The protein encoded by this gene is an enzyme localized to the mitochondrial matrix which catalyzes the oxidative demethylation of sarcosine. This enzyme is distinct from another mitochondrial matrix enzyme, dimethylglycine dehydrogenase, which catalyzes a reaction resulting in the formation of sarcosine. Mutations in this gene are associated with sarcosinemia.
- Molecular Weight
- 67 kDa (MW of target protein)
-