PSD3 antibody (Middle Region)

Catalog No. ABIN629799

The Rabbit Polyclonal anti-PSD3 antibody (ABIN629799) specifically detects PSD3 in WB and IHC. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PSD3 antibody (Middle Region) (ABIN629799)

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PSD3 Antibody

Binding Specificity: Middle Region

Specificity: PSD3 antibody was raised against the middle region of PSD3

Purification: Purified

Immunogen: PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSD3 Blocking Peptide, (ABIN5615610), is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSD3

Target: PSD3 (Pleckstrin and Sec7 Domain Containing 3 (PSD3))

Alternative Name: PSD3

Background: PSD3 is a guanine nucleotide exchange factor for ARF6.

Molecular Weight: 56 kDa (MW of target protein)