PHYHIP antibody (N-Term)

Catalog No. ABIN629804

The Rabbit Polyclonal anti-PHYHIP antibody has been validated for WB. It is suitable to detect PHYHIP in samples from Human, Mouse, Rat and Dog.

Quick Overview for PHYHIP antibody (N-Term) (ABIN629804)

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHYHIP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHYHIP Antibody

Binding Specificity: N-Term

Specificity: PHYHIP antibody was raised against the N terminal of PHYHIP

Purification: Purified

Immunogen: PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHYHIP Blocking Peptide, (ABIN5615355), is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHYHIP

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Alternative Name: PHYHIP

Background: PHYHIP interacts with PHYH suggests a role in the development of the central system.

Molecular Weight: 38 kDa (MW of target protein)