ADH6 antibody
-
- Target See all ADH6 Antibodies
- ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADH6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
- Top Product
- Discover our top product ADH6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADH6 Blocking Peptide, catalog no. 33R-1184, is also available for use as a blocking control in assays to test for specificity of this ADH6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH6 (Alcohol Dehydrogenase 6 (Class V) (ADH6))
- Alternative Name
- ADH6 (ADH6 Products)
- Background
- ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products.
- Molecular Weight
- 32 kDa (MW of target protein)
-