ATIC antibody (N-Term)

Catalog No. ABIN629809

This Rabbit Polyclonal antibody specifically detects ATIC in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for ATIC antibody (N-Term) (ABIN629809)

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATIC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATIC Antibody

Binding Specificity: N-Term

Specificity: ATIC antibody was raised against the N terminal of ATIC

Purification: Purified

Immunogen: ATIC antibody was raised using the N terminal of ATIC corresponding to a region with amino acids YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATIC Blocking Peptide, catalog no. 33R-10290, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATIC

Target: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Alternative Name: ATIC

Background: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Molecular Weight: 64 kDa (MW of target protein)