PPCDC antibody (N-Term)

Catalog No. ABIN629813

The Rabbit Polyclonal anti-PPCDC antibody has been validated for WB. It is suitable to detect PPCDC in samples from Human and Dog.

Quick Overview for PPCDC antibody (N-Term) (ABIN629813)

Target: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPCDC antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPCDC Antibody

Binding Specificity: N-Term

Specificity: PPCDC antibody was raised against the N terminal of PPCDC

Purification: Purified

Immunogen: PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPCDC Blocking Peptide, (ABIN5615490), is also available for use as a blocking control in assays to test for specificity of this PPCDC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPCDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPCDC

Target: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Alternative Name: PPCDC

Background: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process