TCAP antibody

Catalog No. ABIN629822

Product Details anti-TCAP Antibody

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCAP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCAP Blocking Peptide, catalog no. 33R-4117, is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCAP

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Alternative Name: TCAP (TCAP Products)

Synonyms: TCAP antibody, CMD1N antibody, LGMD2G antibody, T-cap antibody, TELE antibody, telethonin antibody, AI503981 antibody, AJ223855 antibody, titin-cap antibody, titin-cap (telethonin) antibody, titin-cap S homeolog antibody, TCAP antibody, tcap antibody, tcap.S antibody, Tcap antibody

Background: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Molecular Weight: 19 kDa (MW of target protein)