14-3-3 zeta antibody (C-Term)

Catalog No. ABIN629824

This Rabbit Polyclonal antibody specifically detects 14-3-3 zeta in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for 14-3-3 zeta antibody (C-Term) (ABIN629824)

Target: 14-3-3 zeta (YWHAZ)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This 14-3-3 zeta antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-14-3-3 zeta Antibody

Binding Specificity: C-Term

Specificity: YWHAZ antibody was raised against the C terminal of YWHAZ

Purification: Purified

Immunogen: YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YWHAZ Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Alternative Name: YWHAZ

Background: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location