UROD antibody (N-Term)

Catalog No. ABIN629827

This Rabbit Polyclonal antibody specifically detects UROD in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for UROD antibody (N-Term) (ABIN629827)

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UROD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-UROD Antibody

Binding Specificity: N-Term

Specificity: UROD antibody was raised against the N terminal of UROD

Purification: Purified

Immunogen: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UROD Blocking Peptide, (ABIN5616924), is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UROD

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Alternative Name: UROD

Background: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Molecular Weight: 40 kDa (MW of target protein)