PRPS2 antibody (N-Term)

Catalog No. ABIN629828

The Rabbit Polyclonal anti-PRPS2 antibody has been validated for WB. It is suitable to detect PRPS2 in samples from Human, Rat, Mouse and Dog.

Quick Overview for PRPS2 antibody (N-Term) (ABIN629828)

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRPS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRPS2 Antibody

Binding Specificity: N-Term

Specificity: PRPS2 antibody was raised against the N terminal of PRPS2

Purification: Purified

Immunogen: PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPS2 Blocking Peptide, (ABIN5615585), is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRPS2

Target: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Alternative Name: PRPS2

Background: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process