ZBP1 antibody (Middle Region)

Catalog No. ABIN629830

Product Details anti-ZBP1 Antibody

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZBP1 antibody was raised against the middle region of ZBP1

Purification: Purified

Immunogen: ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZBP1

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Alternative Name: ZBP1 (ZBP1 Products)

Synonyms: C20orf183 antibody, DAI antibody, DLM-1 antibody, DLM1 antibody, 2010010H03Rik antibody, Dai antibody, Dlm1 antibody, mZaDLM antibody, ZBP1 antibody, Z-DNA binding protein 1 antibody, ZBP1 antibody, Zbp1 antibody

Background: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

Molecular Weight: 47 kDa (MW of target protein)