NNMT antibody (N-Term)

Catalog No. ABIN629835

This anti-NNMT antibody is a Rabbit Polyclonal antibody detecting NNMT in WB. Suitable for Human, Mouse and Rat.

Quick Overview for NNMT antibody (N-Term) (ABIN629835)

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NNMT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NNMT Antibody

Binding Specificity: N-Term

Specificity: NNMT antibody was raised against the N terminal of NNMT

Purification: Purified

Immunogen: NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NNMT Blocking Peptide, (ABIN5615015), is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NNMT

Target: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Alternative Name: NNMT

Background: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

Molecular Weight: 29 kDa (MW of target protein)