TRABD antibody (N-Term)

Catalog No. ABIN629842

This Rabbit Polyclonal antibody specifically detects TRABD in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for TRABD antibody (N-Term) (ABIN629842)

Target: TRABD (TraB Domain Containing (TRABD))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRABD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRABD Antibody

Binding Specificity: N-Term

Specificity: PP2447 antibody was raised against the N terminal Of Pp2447

Purification: Purified

Immunogen: PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PP2447 Blocking Peptide, (ABIN5615480), is also available for use as a blocking control in assays to test for specificity of this PP2447 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PP2447 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRABD

Target: TRABD (TraB Domain Containing (TRABD))

Alternative Name: PP2447

Background: The function of PP2447 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)