ADH1B antibody
-
- Target See all ADH1B Antibodies
- ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADH1B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV
- Top Product
- Discover our top product ADH1B Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADH1B Blocking Peptide, catalog no. 33R-6775, is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))
- Alternative Name
- ADH1B (ADH1B Products)
- Synonyms
- AO090038000108 antibody, ADH antibody, Adh-2 antibody, Adh2 antibody, Dvir\\GJ18209 antibody, GJ18209 antibody, dvir_GLEANR_2772 antibody, ADH2 antibody, adh-2 antibody, adh2 antibody, alcohol dehydrogenase 2 antibody, Alcohol dehydrogenase 2 antibody, alcohol dehydrogenase 1B (class I), beta polypeptide antibody, alcohol dehydrogenase 1B (class I), beta polypeptide L homeolog antibody, CPR_0442 antibody, AOR_1_236174 antibody, AOR_1_178074 antibody, Dvir\Adh2 antibody, adhB antibody, ADH2 antibody, ADH1B antibody, adh1b.L antibody
- Background
- ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.
- Molecular Weight
- 41 kDa (MW of target protein)
-