RBP1 antibody (Middle Region)

Catalog No. ABIN629847

The Rabbit Polyclonal anti-RBP1 antibody (ABIN629847) specifically detects RBP1 in WB. The antibody is reactive with Human, Mouse, Rat and Dog samples.

Quick Overview for RBP1 antibody (Middle Region) (ABIN629847)

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBP1 Antibody

Binding Specificity: Middle Region

Specificity: RBP1 antibody was raised against the middle region of RBP1

Purification: Purified

Immunogen: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBP1 Blocking Peptide, (ABIN939393), is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBP1

Target: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Alternative Name: RBP1

Background: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Molecular Weight: 15 kDa (MW of target protein)