MTMR1 antibody (C-Term)

Catalog No. ABIN629848

This Rabbit Polyclonal antibody specifically detects MTMR1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for MTMR1 antibody (C-Term) (ABIN629848)

Target: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTMR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTMR1 Antibody

Binding Specificity: C-Term

Specificity: MTMR1 antibody was raised against the C terminal of MTMR1

Purification: Purified

Immunogen: MTMR1 antibody was raised using the C terminal of MTMR1 corresponding to a region with amino acids KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTMR1 Blocking Peptide, (ABIN939708), is also available for use as a blocking control in assays to test for specificity of this MTMR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTMR1

Target: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Alternative Name: MTMR1

Background: MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Inositol Metabolic Process