ACP1 antibody (N-Term)

Catalog No. ABIN629849

Product Details anti-ACP1 Antibody

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ACP1 antibody was raised against the N terminal of ACP1

Purification: Purified

Immunogen: ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP1 Blocking Peptide, catalog no. 33R-7150, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP1

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Alternative Name: ACP1 (ACP1 Products)

Synonyms: HAAP antibody, 4632432E04Rik antibody, AI427468 antibody, Acp-1 antibody, LMW-PTP antibody, haap antibody, lmw-ptp antibody, ptp1a antibody, xlptp1 antibody, im:6910498 antibody, zgc:110844 antibody, Acp1 antibody, ACYPI006806 antibody, ACP antibody, ACPH antibody, APH antibody, Acph antibody, CG7899 antibody, Dmel\\CG7899 antibody, DDBDRAFT_0189318 antibody, DDBDRAFT_0266663 antibody, DDB_0189318 antibody, DDB_0266663 antibody, ACP1 antibody, XLPTP1 antibody, acp1 antibody, acp1a antibody, ptp1a-A antibody, LMW-PTPase antibody, acid phosphatase 1 antibody, acid phosphatase 1, soluble antibody, Acid phosphatase 1 antibody, acid phosphatase 1 L homeolog antibody, ACP1 antibody, Acp1 antibody, acp1 antibody, Acph-1 antibody, acp1.L antibody

Background: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.

Molecular Weight: 17 kDa (MW of target protein)