CUEDC1 antibody (Middle Region)

Catalog No. ABIN629850

This anti-CUEDC1 antibody is a Rabbit Polyclonal antibody detecting CUEDC1 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for CUEDC1 antibody (Middle Region) (ABIN629850)

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CUEDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CUEDC1 Antibody

Binding Specificity: Middle Region

Specificity: CUEDC1 antibody was raised against the middle region of CUEDC1

Purification: Purified

Immunogen: CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUEDC1 Blocking Peptide, (ABIN5613031), is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUEDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CUEDC1

Target: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Alternative Name: CUEDC1

Background: The function of CUE protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)