PARP11 antibody

Catalog No. ABIN629858

Product Details anti-PARP11 Antibody

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP11 Blocking Peptide, catalog no. 33R-8294, is also available for use as a blocking control in assays to test for specificity of this PARP11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP11

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Alternative Name: PARP11 (PARP11 Products)

Background: Poly(ADP-ribosyl)ation is a DNA-damage-dependent post-translational modification of histones. Poly(ADP-ribose) polymerases (PARPs) are a family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain.

Molecular Weight: 39 kDa (MW of target protein)