SHMT2 antibody

Catalog No. ABIN629860

This Rabbit Polyclonal antibody specifically detects SHMT2 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for SHMT2 antibody (ABIN629860)

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHMT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SHMT2 Antibody

Purification: Purified

Immunogen: SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHMT2 Blocking Peptide, (ABIN937936), is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHMT2

Target: SHMT2 (serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2))

Alternative Name: SHMT2

Background: SHMT2 plays a role in interconversion of serine and glycine.

Molecular Weight: 56 kDa (MW of target protein)