STIP1 antibody
-
- Target See all STIP1 Antibodies
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STIP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM
- Top Product
- Discover our top product STIP1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STIP1 Blocking Peptide, catalog no. 33R-1327, is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
- Alternative Name
- STIP1 (STIP1 Products)
- Synonyms
- HOP antibody, IEF-SSP-3521 antibody, P60 antibody, STI1 antibody, STI1L antibody, Hop antibody, Sti1 antibody, p60 antibody, MGC53256 antibody, stip1 antibody, MGC76181 antibody, MGC82554 antibody, zgc:92133 antibody, stress induced phosphoprotein 1 antibody, stress-induced phosphoprotein 1 antibody, stress induced phosphoprotein 1 L homeolog antibody, Stress-induced-phosphoprotein 1 antibody, stress-induced-phosphoprotein 1 antibody, stress induced phosphoprotein 1 S homeolog antibody, STIP1 antibody, Stip1 antibody, stip1.L antibody, GL50803_27310 antibody, PGTG_06468 antibody, stip1 antibody, stip1.S antibody
- Background
- STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
- Molecular Weight
- 63 kDa (MW of target protein)
-