STIP1 antibody

Catalog No. ABIN629862

The Rabbit Polyclonal anti-STIP1 antibody (ABIN629862) specifically detects STIP1 in WB and IHC. The antibody is reactive with Human, Mouse, Rat and Dog samples.

Quick Overview for STIP1 antibody (ABIN629862)

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STIP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-STIP1 Antibody

Purification: Purified

Immunogen: STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STIP1 Blocking Peptide, (ABIN936185), is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STIP1

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Alternative Name: STIP1

Background: STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Molecular Weight: 63 kDa (MW of target protein)