IFI44L antibody (N-Term)

Catalog No. ABIN629863

This Rabbit Polyclonal antibody specifically detects IFI44L in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for IFI44L antibody (N-Term) (ABIN629863)

Target: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFI44L antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-IFI44L Antibody

Binding Specificity: N-Term

Specificity: IFI44 L antibody was raised against the N terminal of IFI44

Purification: Purified

Immunogen: IFI44 L antibody was raised using the N terminal of IFI44 corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFI44L Blocking Peptide, (ABIN5614141), is also available for use as a blocking control in assays to test for specificity of this IFI44L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFI44L

Target: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Alternative Name: IFI44L

Background: The function of this gene remains unknown.

Molecular Weight: 47 kDa (MW of target protein)