LZTFL1 antibody (C-Term)

Catalog No. ABIN629864

The Rabbit Polyclonal anti-LZTFL1 antibody has been validated for WB. It is suitable to detect LZTFL1 in samples from Human, Mouse and Rat.

Quick Overview for LZTFL1 antibody (C-Term) (ABIN629864)

Target: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LZTFL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LZTFL1 Antibody

Binding Specificity: C-Term

Specificity: LZTFL1 antibody was raised against the C terminal of LZTFL1

Purification: Purified

Immunogen: LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LZTFL1 Blocking Peptide, (ABIN5614620), is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LZTFL1

Target: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Alternative Name: LZTFL1

Background: LZTFL1 may be involved in vesicle-mediated transport.

Molecular Weight: 34 kDa (MW of target protein)