HSPB6 antibody (Middle Region)

Catalog No. ABIN629865

Product Details anti-HSPB6 Antibody

Target: HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPB6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPB6 antibody was raised against the middle region of HSPB6

Purification: Purified

Immunogen: HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPB6 Blocking Peptide, catalog no. 33R-1474, is also available for use as a blocking control in assays to test for specificity of this HSPB6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPB6

Target: HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))

Alternative Name: HSPB6 (HSPB6 Products)

Synonyms: Hsp20 antibody, p20 antibody, AA387366 antibody, Gm479 antibody, HSP20 antibody, heat shock protein family B (small) member 6 antibody, heat shock protein, alpha-crystallin-related, B6 antibody, heat shock protein family B (small) member 6 L homeolog antibody, heat shock protein, alpha-crystallin-related, b6 antibody, HSPB6 antibody, Hspb6 antibody, hspb6.L antibody, hspb6 antibody

Background: HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin and modulates smooth muscle relaxation.

Molecular Weight: 17 kDa (MW of target protein)