MOV10 antibody
-
- Target See all MOV10 Antibodies
- MOV10 (Moloney Leukemia Virus 10 (MOV10))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MOV10 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
- Top Product
- Discover our top product MOV10 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOV10 (Moloney Leukemia Virus 10 (MOV10))
- Alternative Name
- MOV10 (MOV10 Products)
- Background
- MOV10 may be an helicase with an important function in development and/or control of cell proliferation.
- Molecular Weight
- 110 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome
-