DDX49 antibody

Catalog No. ABIN629881

This Rabbit Polyclonal antibody specifically detects DDX49 in WB. It exhibits reactivity toward Human, Dog and Mouse.

Quick Overview for DDX49 antibody (ABIN629881)

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Reactivity: Human, Dog, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX49 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX49 Antibody

Purification: Purified

Immunogen: DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX49 Blocking Peptide, (ABIN937916), is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX49

Target: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Alternative Name: DDX49

Background: The function of Anti-DDX49 has not yet been determined.

Molecular Weight: 53 kDa (MW of target protein)