PPP1R8 antibody

Catalog No. ABIN629887

This Rabbit Polyclonal antibody specifically detects PPP1R8 in WB and IHC. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for PPP1R8 antibody (ABIN629887)

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP1R8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PPP1R8 Antibody

Purification: Purified

Immunogen: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP1R8 Blocking Peptide, (ABIN5615513), is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Alternative Name: PPP1R8

Background: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Molecular Weight: 14 kDa (MW of target protein)