PPP1R8 antibody

Catalog No. ABIN7272976

The Goat Polyclonal anti-PPP1R8 antibody (ABIN7272976) specifically detects PPP1R8 in WB. The antibody is reactive with Archaeoprepona samples.

Quick Overview for PPP1R8 antibody (ABIN7272976)

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivity: Archaeoprepona

Host: Goat

Clonality: Polyclonal

Conjugate: This PPP1R8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP1R8 Antibody

Purpose: Anti-ARD1

Sequence: MDKLIGSCVW GAVNYTSNCR AECKRRGYKG GHCGSFANVN CWCET

Specificity: Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin

Cross-Reactivity (Details): Archeoprepona genus

Characteristics: Chain A defensin ARD1

Purification: Epitope affinity purified

Immunogen: Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli

Isotype: IgG

Application Details

Application Notes: WB:1:500-1:2,000

Restrictions: For Research Use only

Handling

Concentration: 2 mg/mL

Buffer: PBS, 20 % glycerol and 0.05 % sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: The antibody solution should be gently mixed before use.

Storage: 4 °C,-20 °C

Storage Comment: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.

Target Details for PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Alternative Name: ARD1

Background:

Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.

Heliomycin, ETD135, ETD151 antibody.