HNRNPH3 antibody

Catalog No. ABIN629899

This Rabbit Polyclonal antibody specifically detects HNRNPH3 in WB and IHC. It exhibits reactivity toward Human, Rat, Mouse and Dog.

Quick Overview for HNRNPH3 antibody (ABIN629899)

Target: HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPH3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-HNRNPH3 Antibody

Purification: Purified

Immunogen: HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPH3 Blocking Peptide, (ABIN937630), is also available for use as a blocking control in assays to test for specificity of this HNRPH3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPH3

Target: HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))

Alternative Name: HNRPH3

Background: HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Molecular Weight: 38 kDa (MW of target protein)