RPP29 antibody

Catalog No. ABIN629915

The Rabbit Polyclonal anti-RPP29 antibody has been validated for WB and IHC. It is suitable to detect RPP29 in samples from Human and Dog.

Quick Overview for RPP29 antibody (ABIN629915)

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPP29 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-RPP29 Antibody

Purification: Purified

Immunogen: POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POP4 Blocking Peptide, (ABIN937713), is also available for use as a blocking control in assays to test for specificity of this POP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPP29

Target: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Alternative Name: POP4

Background: POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Molecular Weight: 24 kDa (MW of target protein)