Trnt1 antibody (N-Term)

Catalog No. ABIN629918

The Rabbit Polyclonal anti-Trnt1 antibody has been validated for WB and IHC. It is suitable to detect Trnt1 in samples from Human.

Quick Overview for Trnt1 antibody (N-Term) (ABIN629918)

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Trnt1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Trnt1 Antibody

Binding Specificity: N-Term

Specificity: TRNT1 antibody was raised against the N terminal of TRNT1

Purification: Purified

Immunogen: TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRNT1 Blocking Peptide, (ABIN5616798), is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Trnt1

Target: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Alternative Name: TRNT1

Background: TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Molecular Weight: 45 kDa (MW of target protein)