Nucleolar Protein 6 antibody
-
- Target See all Nucleolar Protein 6 (NOL6) Antibodies
- Nucleolar Protein 6 (NOL6)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nucleolar Protein 6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG
- Top Product
- Discover our top product NOL6 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOL6 Blocking Peptide, catalog no. 33R-9597, is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nucleolar Protein 6 (NOL6)
- Alternative Name
- NOL6 (NOL6 Products)
- Background
- NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.
- Molecular Weight
- 22 kDa (MW of target protein)
-