CPSF3 antibody (C-Term)

Catalog No. ABIN629924

The Rabbit Polyclonal anti-CPSF3 antibody has been validated for WB and IHC. It is suitable to detect CPSF3 in samples from Human.

Quick Overview for CPSF3 antibody (C-Term) (ABIN629924)

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CPSF3 Antibody

Binding Specificity: C-Term

Specificity: CPSF3 antibody was raised against the C terminal of CPSF3

Purification: Purified

Immunogen: CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF3 Blocking Peptide, (ABIN937275), is also available for use as a blocking control in assays to test for specificity of this CPSF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF3

Target: CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))

Alternative Name: CPSF3

Background: CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.

Molecular Weight: 75 kDa (MW of target protein)