CPEB2 antibody (Middle Region)

Catalog No. ABIN629930

The Rabbit Polyclonal anti-CPEB2 antibody has been validated for WB. It is suitable to detect CPEB2 in samples from Human, Mouse, Rat, Dog, Zebrafish (Danio rerio) and Drosophila melanogaster.

Quick Overview for CPEB2 antibody (Middle Region) (ABIN629930)

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPEB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPEB2 Antibody

Binding Specificity: Middle Region

Specificity: CPEB2 antibody was raised against the middle region of CPEB2

Purification: Purified

Immunogen: CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPEB2 Blocking Peptide, (ABIN937577), is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPEB2

Target: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Alternative Name: CPEB2

Background: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Molecular Weight: 37 kDa (MW of target protein)