Fibrillarin antibody (N-Term)

Catalog No. ABIN629933

The Rabbit Polyclonal anti-Fibrillarin antibody has been validated for WB and IHC. It is suitable to detect Fibrillarin in samples from Human, Rat, Mouse and Dog.

Quick Overview for Fibrillarin antibody (N-Term) (ABIN629933)

Target: Fibrillarin (FBL)

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibrillarin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Fibrillarin Antibody

Binding Specificity: N-Term

Specificity: Fibrillarin antibody was raised against the N terminal of FBL

Purification: Purified

Immunogen: Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibrillarin Blocking Peptide, (ABIN938665), is also available for use as a blocking control in assays to test for specificity of this Fibrillarin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibrillarin

Target: Fibrillarin (FBL)

Alternative Name: Fibrillarin

Background: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognise fibrillarin.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process