TROVE2 antibody (N-Term)

Catalog No. ABIN629945

The Rabbit Polyclonal anti-TROVE2 antibody has been validated for WB and IHC. It is suitable to detect TROVE2 in samples from Human.

Quick Overview for TROVE2 antibody (N-Term) (ABIN629945)

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TROVE2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TROVE2 Antibody

Binding Specificity: N-Term

Specificity: TROVE2 antibody was raised against the N terminal of TROVE2

Purification: Purified

Immunogen: TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TROVE2 Blocking Peptide, (ABIN5616809), is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TROVE2

Target: TROVE2 (TROVE Domain Family, Member 2 (TROVE2))

Alternative Name: TROVE2

Background: As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.

Molecular Weight: 58 kDa (MW of target protein)