TROVE2 antibody (TROVE Domain Family, Member 2) (N-Term)

Details for Product anti-TROVE2 Antibody No. ABIN629945
Antigen
  • SSA2
  • TROVE2
  • ssa2
  • ssa2-A
  • RO60
  • RORNP
  • 1810007I17Rik
  • A530054J02Rik
  • AI646302
  • SS-A/Ro
  • Ssa
  • Ssa2
  • TROVE domain family member 2
  • TROVE domain family, member 2
  • TROVE domain family member 2 L homeolog
  • TROVE2
  • trove2
  • trove2.L
  • Trove2
Epitope
N-Term
10
9
7
4
4
4
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
107
34
27
6
4
4
3
3
3
1
1
Host
Rabbit
97
11
Clonality
Polyclonal
Conjugate
This TROVE2 antibody is un-conjugated
7
6
6
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
87
52
23
13
11
5
4
3
1
1
1
Options
Immunogen TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
Specificity TROVE2 antibody was raised against the N terminal of TROVE2
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others TROVE2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name TROVE2 (TROVE2 Antibody Abstract)
Background As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
Molecular Weight 58 kDa (MW of target protein)
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TROVE2 Blocking Peptide, catalog no. 33R-7607, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibody (ABIN629945) TROVE2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to ...
Image no. 2 for anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibody (ABIN629945) TROVE2 antibody used at 2.5 ug/ml to detect target protein.
Did you look for something else?