GRSF1 antibody (N-Term)

Catalog No. ABIN629949

This anti-GRSF1 antibody is a Rabbit Polyclonal antibody detecting GRSF1 in WB. Suitable for Human.

Quick Overview for GRSF1 antibody (N-Term) (ABIN629949)

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GRSF1 Antibody

Binding Specificity: N-Term

Specificity: GRSF1 antibody was raised against the N terminal of GRSF1

Purification: Purified

Immunogen: GRSF1 antibody was raised using the N terminal of GRSF1 corresponding to a region with amino acids SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRSF1 Blocking Peptide, (ABIN5613876), is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRSF1

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Alternative Name: GRSF1

Background: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Molecular Weight: 47 kDa (MW of target protein)