DDX5 antibody

Catalog No. ABIN629955

Product Details anti-DDX5 Antibody

Target: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX5 Blocking Peptide, catalog no. 33R-8427, is also available for use as a blocking control in assays to test for specificity of this DDX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX5

Target: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Alternative Name: DDX5 (DDX5 Products)

Synonyms: G17P1 antibody, HLR1 antibody, HUMP68 antibody, p68 antibody, 2600009A06Rik antibody, Hlr1 antibody, wu:fa56a07 antibody, wu:fb11e01 antibody, wu:fb16c10 antibody, wu:fb53b05 antibody, ddx5 antibody, DEAD-box helicase 5 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 antibody, DEAD (Asp-Glu-Ala-Asp) box helicase 5 antibody, DEAD-box helicase 5 L homeolog antibody, DDX5 antibody, Ddx5 antibody, ddx5 antibody, ddx5.L antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, Regulation of Muscle Cell Differentiation, Positive Regulation of Response to DNA Damage Stimulus