EIF4A3 antibody

Catalog No. ABIN629957

The Rabbit Polyclonal anti-EIF4A3 antibody has been validated for WB. It is suitable to detect EIF4A3 in samples from Human, Mouse, Rat, Dog, Zebrafish (Danio rerio) and C. elegans.

Quick Overview for EIF4A3 antibody (ABIN629957)

Target: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF4A3 Antibody

Purification: Purified

Immunogen: DDX48 antibody was raised using a synthetic peptide corresponding to a region with amino acids QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX48 Blocking Peptide, (ABIN5613166), is also available for use as a blocking control in assays to test for specificity of this DDX48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4A3

Target: EIF4A3 (Eukaryotic Translation Initiation Factor 4A3 (EIF4A3))

Alternative Name: DDX48

Background: DDX48 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 45 kDa (MW of target protein)