RPS14 antibody (N-Term)

Catalog No. ABIN629966

The Rabbit Polyclonal anti-RPS14 antibody has been validated for WB. It is suitable to detect RPS14 in samples from Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for RPS14 antibody (N-Term) (ABIN629966)

Target: RPS14 (Ribosomal Protein S14 (RPS14))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS14 Antibody

Binding Specificity: N-Term

Specificity: RPS14 antibody was raised against the N terminal of RPS14

Purification: Purified

Immunogen: RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS14

Target: RPS14 (Ribosomal Protein S14 (RPS14))

Alternative Name: RPS14

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly