MSI2 antibody

Catalog No. ABIN629967

This anti-MSI2 antibody is a Rabbit Polyclonal antibody detecting MSI2 in WB and IHC. Suitable for Human, Mouse, Rat, Zebrafish (Danio rerio) and C. elegans.

Quick Overview for MSI2 antibody (ABIN629967)

Target: MSI2 (Musashi Homolog 2 (MSI2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MSI2 Antibody

Purification: Purified

Immunogen: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSI2 Blocking Peptide, (ABIN5614853), is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSI2

Target: MSI2 (Musashi Homolog 2 (MSI2))

Alternative Name: MSI2

Background: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Molecular Weight: 36 kDa (MW of target protein)