MSI2 antibody

Catalog No. ABIN629967

The Rabbit Polyclonal anti-MSI2 antibody (ABIN629967) specifically detects MSI2 in WB and IHC. The antibody is reactive with Human, Mouse, Rat, Zebrafish (Danio rerio) and C. elegans samples.

Quick Overview for MSI2 antibody (ABIN629967)

Target: MSI2 (Musashi Homolog 2 (MSI2))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSI2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-MSI2 Antibody

Purification: Purified

Immunogen: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSI2 Blocking Peptide, (ABIN5614853), is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSI2

Target: MSI2 (Musashi Homolog 2 (MSI2))

Alternative Name: MSI2

Background: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Molecular Weight: 36 kDa (MW of target protein)